PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016440040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 89aa    MW: 10211.8 Da    PI: 10.2883
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016440040.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.8e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ed++l++++ ++G  +W++++   g+ R +k+c++rw +yl
   XP_016440040.1 15 KGLWSPDEDDKLKNYIIKHGHSCWSSVPINAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-22965IPR009057Homeodomain-like
PROSITE profilePS5129422.3431066IPR017930Myb domain
SMARTSM007174.2E-111464IPR001005SANT/Myb domain
PfamPF002495.5E-141562IPR001005SANT/Myb domain
SuperFamilySSF466891.03E-191789IPR009057Homeodomain-like
CDDcd001671.64E-91862No hitNo description
Gene3DG3DSA:1.10.10.602.1E-76689IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGCKSVDKTK QKHKKGLWSP DEDDKLKNYI IKHGHSCWSS VPINAGLQRN GKSCRLRWIN  60
YLRPGLKRGA FSLDEEETIL TLHAMFGNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629823.12e-60PREDICTED: transcription factor LAF1-like
RefseqXP_016440040.19e-62PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K45e-40LAF1_ARATH; Transcription factor LAF1
TrEMBLM1B4S43e-54M1B4S4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370809e-54(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-41myb domain protein 18